PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00039668-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 180aa    MW: 20865.4 Da    PI: 7.0986
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00039668-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.71.8e-10101141345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       rW++ E e++++a +q+G++ +  I + ++ gRt+ q+k ++ 
  PSME_00039668-RA 101 RWSKSETERFYKAMQQFGTD-FGMIQHLFP-GRTRRQVKAKFK 141
                       9*******************.*********.********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.2E-2792159No hitNo description
SMARTSM007171.0E-798146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-7100141IPR009057Homeodomain-like
SuperFamilySSF466891.42E-11100148IPR009057Homeodomain-like
CDDcd001674.54E-7101142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MENKQQATNR KSCLSETALN SNANEPGKES QEDEGNEIPC CRVVLAPQVQ VINGQIVINE  60
ESLVVSHREL NVDDTQTYRR VEETSSKLNY HTYMNRAPVE RWSKSETERF YKAMQQFGTD  120
FGMIQHLFPG RTRRQVKAKF KMEERKHPLQ LADALIHRPQ GGHLLSLTSD CVYDWYNVFC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001755778.12e-44predicted protein
TrEMBLA9RNT42e-44A9RNT4_PHYPA; Predicted protein
STRINGPP1S19_81V6.14e-45(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-25MYB_related family protein